PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K01541.1.p
Common NameEUGRSUZ_K01541, LOC104425307
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 498aa    MW: 53730.6 Da    PI: 8.2109
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K01541.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.81.1e-38113172261
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                       ++k+l+cprC+s +tkfCy+nny+++qPr+fC++C+ryWt+GG++rnvP+G+grrknk+ 
  Eucgr.K01541.1.p 113 PDKILPCPRCNSLETKFCYFNNYNVNQPRHFCRNCQRYWTAGGTMRNVPIGAGRRKNKHL 172
                       7899******************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-29101170IPR003851Zinc finger, Dof-type
PfamPF027011.4E-31115171IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.537117171IPR003851Zinc finger, Dof-type
PROSITE patternPS013610119155IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MVLALRARER DSADKMSGGG FVSENKDPGI KLFGRNIPVP DCRVPAGSAG GSRALSDSEV  60
THACSDIEKP ETVKYGHPHN SAVGGEKAMV MRNLQNGHAE TKYADQEKVF KKPDKILPCP  120
RCNSLETKFC YFNNYNVNQP RHFCRNCQRY WTAGGTMRNV PIGAGRRKNK HLASQYCQAT  180
LSSSSTLNTR LDIPEMTVNH QFMAPKEITS TTLGPSVGNA RVLKFGPEAS LSESVETVLS  240
LKDPKISIET GSINCVQTRE EVSSSGSSMT TYSIHDSTKS AAENEEIGIS GSRREQNSLD  300
PMHFYPVPAC FIPLNTGWQH LASFRTTQYS PEQVAGVASP NSVHLSSTPM LAVPGICPPS  360
IPLQIVPMAP YFGCMPLRPS GLSTTPSSGM NSGPSSSSPS SPMGNAYCSA SASPTLGKHS  420
RDANFADFER SDKCILVPKT LRMDNPSEAS KIPIWATLGI KPGKAKVENE LNDSDATHMM  480
EVNPAAFSRS QTFQEST*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K01541.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010036266.10.0PREDICTED: cyclic dof factor 3-like isoform X1
TrEMBLA0A059A1X60.0A0A059A1X6_EUCGR; Uncharacterized protein
STRINGPOPTR_0013s06290.11e-145(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM155911017
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.12e-39cycling DOF factor 3